Loading...
Statistics
Advertisement

Attention Required! | CloudFlare
www.sputnikhosting.com/

Sputnikhosting.com

Advertisement
Conversion Technology Metas Server
Sputnikhosting.com is hosted in United States . Sputnikhosting.com uses HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Html, Html5, Number of used javascripts: 3. First javascripts: Zepto.min.js, Cf.common.js, Cf.challenge.js, Number of used analytics tools: 0. Its server type is: cloudflare-nginx.

Technologies in use by Sputnikhosting.com

Technology

Number of occurences: 5
  • CSS
  • Html
  • Html5
  • Iframe
  • Javascript

Advertisement

Javascripts

Number of occurences: 3
  • zepto.min.js
  • cf.common.js
  • cf.challenge.js

Server Type

  • cloudflare-nginx

CDN

Number of occurences: 1
  • CloudFlare

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Sputnikhosting.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL Multi-Domain/CN=sni150832.cloudflaressl.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL Multi-Domain
      • CN: sni150832.cloudflaressl.com
    • hash: de89c2ce
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO ECC Domain Validation Secure Server CA 2
    • version: 2
    • serialNumber: 114096035041677707298721085890938274097
    • validFrom: 160802000000Z
    • validTo: 170205235959Z
    • validFrom_time_t: 1470096000
    • validTo_time_t: 1486339199
    • extensions:
      • authorityKeyIdentifier: keyid:40:09:61:67:F0:BC:83:71:4F:DE:12:08:2C:6F:D4:D4:2B:76:3D:96
      • subjectKeyIdentifier: 59:14:1F:8D:32:AE:91:C5:F5:A1:C5:C9:F6:EB:B9:9B:99:F8:27:4D
      • keyUsage: Digital Signature
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca4.com/COMODOECCDomainValidationSecureServerCA2.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca4.com/COMODOECCDomainValidationSecureServerCA2.crt OCSP - URI:http://ocsp.comodoca4.com
      • subjectAltName: DNS:sni150832.cloudflaressl.com, DNS:*.beeutylife.com, DNS:*.bestknifesharpeningsystemreview.com, DNS:*.bestpersonalblenderreview.com, DNS:*.bloggingbrilliance.info, DNS:*.buildmyownvps.com, DNS:*.buildyourownvps.com, DNS:*.chainsawraw.com, DNS:*.chefstricks.info, DNS:*.jamjarstorage.com, DNS:*.lifetheuniverseandeverything.website, DNS:*.marmeloconsulting.com, DNS:*.recruitforteachers.com, DNS:*.sputnikhosting.com, DNS:*.tshirtsusa.co, DNS:*.w-diks.nl, DNS:beeutylife.com, DNS:bestknifesharpeningsystemreview.com, DNS:bestpersonalblenderreview.com, DNS:bloggingbrilliance.info, DNS:buildmyownvps.com, DNS:buildyourownvps.com, DNS:chainsawraw.com, DNS:chefstricks.info, DNS:jamjarstorage.com, DNS:lifetheuniverseandeverything.website, DNS:marmeloconsulting.com, DNS:recruitforteachers.com, DNS:sputnikhosting.com, DNS:tshirtsusa.co, DNS:w-diks.nl

Meta - Sputnikhosting.com

Number of occurences: 3
  • Name:
    Content: IE=Edge,chrome=1
  • Name: robots
    Content: noindex, nofollow
  • Name: viewport
    Content: width=device-width,initial-scale=1,maximum-scale=1

Server / Hosting

  • IP: 104.27.182.127
  • Latitude: 37.75
  • Longitude: -97.82
  • Country: United States

Rname

  • beth.ns.cloudflare.com
  • fred.ns.cloudflare.com

Target

  • dns.cloudflare.com

HTTP Header Response

HTTP/1.1 200 OK Date: Tue, 02 Aug 2016 15:36:50 GMT Content-Type: text/html Set-Cookie: __cfduid=da37b922cc2fe54b77445b12b81090c031470152210; expires=Wed, 02-Aug-17 15:36:50 GMT; path=/; domain=.sputnikhosting.com; HttpOnly Last-Modified: Mon, 27 Jun 2016 14:44:36 GMT Accept-Ranges: bytes Server: cloudflare-nginx CF-RAY: 2cc29b93a4d62617-DFW X-Cache: MISS from s_sr109 X-Cache-Lookup: MISS from s_sr109:80 Transfer-Encoding: chunked Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive

DNS

host: sputnikhosting.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 104.27.182.127
host: sputnikhosting.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 104.27.183.127
host: sputnikhosting.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: beth.ns.cloudflare.com
host: sputnikhosting.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: fred.ns.cloudflare.com
host: sputnikhosting.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: beth.ns.cloudflare.com
  5. rname: dns.cloudflare.com
  6. serial: 2022111690
  7. refresh: 10000
  8. retry: 2400
  9. expire: 604800
  10. minimum-ttl: 3600
host: sputnikhosting.com
  1. class: IN
  2. ttl: 300
  3. type: AAAA
  4. ipv6: 2400:cb00:2048:1::681b:b67f
host: sputnikhosting.com
  1. class: IN
  2. ttl: 300
  3. type: AAAA
  4. ipv6: 2400:cb00:2048:1::681b:b77f

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.putnikhosting.com, www.seputnikhosting.com, www.eputnikhosting.com, www.swputnikhosting.com, www.wputnikhosting.com, www.sdputnikhosting.com, www.dputnikhosting.com, www.sxputnikhosting.com, www.xputnikhosting.com, www.sfputnikhosting.com, www.fputnikhosting.com, www.sgputnikhosting.com, www.gputnikhosting.com, www.stputnikhosting.com, www.tputnikhosting.com, www.sutnikhosting.com, www.spiutnikhosting.com, www.siutnikhosting.com, www.spkutnikhosting.com, www.skutnikhosting.com, www.spuutnikhosting.com, www.suutnikhosting.com, www.spjutnikhosting.com, www.sjutnikhosting.com, www.splutnikhosting.com, www.sptnikhosting.com, www.spuwtnikhosting.com, www.spwtnikhosting.com, www.spuetnikhosting.com, www.spetnikhosting.com, www.spustnikhosting.com, www.spstnikhosting.com, www.spuatnikhosting.com, www.spatnikhosting.com, www.spunikhosting.com, www.sputqnikhosting.com, www.spuqnikhosting.com, www.sputanikhosting.com, www.spuanikhosting.com, www.sput nikhosting.com, www.spu nikhosting.com, www.sputwnikhosting.com, www.spuwnikhosting.com, www.sputenikhosting.com, www.spuenikhosting.com, www.sputznikhosting.com, www.spuznikhosting.com, www.sputxnikhosting.com, www.spuxnikhosting.com, www.sputcnikhosting.com, www.spucnikhosting.com, www.sputikhosting.com, www.sputnnikhosting.com, www.sputnikhosting.com, www.sputnhikhosting.com, www.sputhikhosting.com, www.sputnjikhosting.com, www.sputjikhosting.com, www.sputnkikhosting.com, www.sputkikhosting.com, www.sputnlikhosting.com, www.sputlikhosting.com, www.sputn ikhosting.com, www.sput ikhosting.com, www.sputnkhosting.com, www.sputnirkhosting.com, www.sputnrkhosting.com, www.sputnifkhosting.com, www.sputnfkhosting.com, www.sputnivkhosting.com, www.sputnvkhosting.com, www.sputnikkhosting.com, www.sputnkkhosting.com, www.sputni,khosting.com, www.sputn,khosting.com, www.sputnibkhosting.com, www.sputnbkhosting.com, www.sputnigkhosting.com, www.sputngkhosting.com, www.sputnitkhosting.com, www.sputntkhosting.com, www.sputniykhosting.com, www.sputnykhosting.com, www.sputniukhosting.com, www.sputnukhosting.com, www.sputnijkhosting.com, www.sputnjkhosting.com, www.sputnimkhosting.com, www.sputnmkhosting.com, www.sputninkhosting.com, www.sputnnkhosting.com, www.sputnihosting.com, www.sputnikthosting.com, www.sputnithosting.com, www.sputnikhosting.com, www.sputnihosting.com, www.sputnikghosting.com, www.sputnighosting.com, www.sputnikbhosting.com, www.sputnibhosting.com, www.sputniknhosting.com, www.sputninhosting.com, www.sputnikhhosting.com, www.sputnihhosting.com, www.sputnikyhosting.com, www.sputniyhosting.com, www.sputniklhosting.com, www.sputnilhosting.com, www.sputnikohosting.com, www.sputniohosting.com, www.sputnikuhosting.com, www.sputniuhosting.com, www.sputnikihosting.com, www.sputniihosting.com, www.sputnikmhosting.com, www.sputnimhosting.com, www.sputnikosting.com, www.sputnikheosting.com, www.sputnikeosting.com, www.sputnikhdosting.com, www.sputnikdosting.com, www.sputnikhcosting.com, www.sputnikcosting.com, www.sputnikhuosting.com, www.sputnikuosting.com, www.sputnikhjosting.com, www.sputnikjosting.com, www.sputnikhosting.com, www.sputnikosting.com, www.sputnikhbosting.com, www.sputnikbosting.com, www.sputnikhgosting.com, www.sputnikgosting.com, www.sputnikhsting.com, www.sputnikhobsting.com, www.sputnikhbsting.com, www.sputnikhohsting.com, www.sputnikhhsting.com, www.sputnikhogsting.com, www.sputnikhgsting.com, www.sputnikhojsting.com, www.sputnikhjsting.com, www.sputnikhomsting.com, www.sputnikhmsting.com, www.sputnikho sting.com, www.sputnikh sting.com, www.sputnikhovsting.com, www.sputnikhvsting.com, www.sputnikhoting.com, www.sputnikhoseting.com, www.sputnikhoeting.com, www.sputnikhoswting.com, www.sputnikhowting.com, www.sputnikhosdting.com, www.sputnikhodting.com, www.sputnikhosxting.com, www.sputnikhoxting.com, www.sputnikhosfting.com, www.sputnikhofting.com, www.sputnikhosgting.com, www.sputnikhogting.com, www.sputnikhostting.com, www.sputnikhotting.com,

Other websites we recently analyzed

  1. Àрхивное дело: генеалогия, история семьи, составление родословных, архивный поиск, консультации
    Архивное дело: генеалогия, поиск и анализ информации в архивах, составление родословных, изучение истории семьи, подтверждение прав на наследство, частный архив,архивные справки, консультации
    Germany - 5.9.107.59
    Server software: Apache
    Technology: Google Adsense, Iframe, Javascript, Php, HotLog, Rambler
    Number of Javascript: 2
    Number of meta tags: 6
  2. turski.info
    Norway - 91.207.158.13
    Server software: nginx
    Technology: Html
  3. hansemerkurvertriebsportal.net
    Germany - 217.6.199.131
    Server software: Apache
    Technology: Html
  4. Enseignes, Publicité - Signalétique et Découpe numérique 35 | ACTUA DECORS
    Si vous recherchez un fabricant d’enseignes pour vos publicités, contactez ACTUA DECORS.
    France - 46.105.39.31
    Server software: Apache/2.2.16 (Debian)
    Technology: CSS, Html, Javascript, Php, Swf Object
    Number of Javascript: 15
    Number of meta tags: 4
  5. LCD TV: Prices, Consumer Reviews, Find LCD TVs you want.
    LCD TV Prices, Reviews, and information on all of the Top Brand Names. Including Sony, Samsung, Panasonic, Toshiba and more.
    Pittsburgh (United States) - 66.39.32.71
    Server software: Apache/2.2.31
    Technology: CSS, Html, Iframe, Javascript, Clicky Web Analytics
    Number of Javascript: 2
    Number of meta tags: 2
  6. www.analysethermique.com
    www.analysethermique.com
    Portugal - 217.76.129.34
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Php
    Number of meta tags: 4
  7. innerwheelhubli.org
    Houston (United States) - 192.185.136.65
    Server software: nginx/1.10.1
    Technology: CSS, Flexslider, Html, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 7
    Number of meta tags: 4
  8. elalbuelo.com - Diese Website steht zum Verkauf! - Informationen zum Thema elalbuelo.
    Diese Website steht zum Verkauf! elalbuelo.com ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf elalbuelo.com alles. Wir hoffen, dass Sie hier das Gesuchte finden!
    Cambridge (United States) - 72.52.4.90
    Server software: Apache
    Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 4
    Number of meta tags: 5
  9. overthecounterbulkdrugs.com
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  10. Restaurante La Menorquina
    Germany - 217.160.230.61
    Server software: Apache
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1

Check Other Websites